SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9NY33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9NY33
Domain Number 1 Region: 545-786
Classification Level Classification E-value
Superfamily VPS9 domain 4.71e-55
Family VPS9 domain 0.001
Further Details:      
 
Domain Number 2 Region: 93-214
Classification Level Classification E-value
Superfamily SH2 domain 5.65e-17
Family SH2 domain 0.0015
Further Details:      
 
Domain Number 3 Region: 803-884
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000209
Family Ras-binding domain, RBD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9NY33
Sequence length 908
Comment (tr|J9NY33|J9NY33_CANLF) Ras and Rab interactor 2 {ECO:0000313|Ensembl:ENSCAFP00000038200} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=RIN2 OC=Canis.
Sequence
MSAWTMGARGLDKRGSFFKLIDTIVSEIGELKQEMVQTDVSLENGLEASKSHSMVRHKDD
GYSEEKDMKTCPRDSGYDSLSSRLSILDRLLHTHPIWLQLSLSEEEAAQVLRSQPPGIFL
VRKSTKMQKKVLSLRLPCEFGAPLKEFAIKESTYTFSLEGSGISFADLFRLIAFYCISRD
VLPFTLKLPYAISTAKTEAQLEELAQLGLNFWSSPADNKPPNPPPPHRPPSSDGVCPASR
QLCLINGVHSIKTRTPSELECSQTNGALCFINPLFLKVHSQDLSGGPKRPCTRTPNANGT
ERPRSPPPRPPPPAINSLHTSPQLSRAETPASMPETVNHNKHGNVALLGTKPAPIPPPRL
KKQAFFLDAEGSAKTLTGGRPRPGQERPEPQEPQAPQEPEPEPGPGTAGRPGRAPPAEAP
GDCTRAAGPESRPPWHGGGQRLSDMSLSTSSSDSLEFDRSMPLFGYEADTNSSLEDCEEE
SDQETLAPPIKSKKKRNGSFVLPKLVKSQLRKMSGVFSSFLTPEKRMVRRIAELSRDKCT
YFGCLVQDYVSFLQENKECHVSSTDMLQTIRQFMTQVKNYLSQSSELDPPIESLIPEDQI
DVVLEKAMHKCILKPLKGHVEAMLRDFHMADGSWKQLKENLQLVRQRNPQELGVFAPTPD
FVDVEKIKVKFMTMQKMYSPEKKVMLLLRVCKLIYTVMENNSGRMYGADDFLPVLTYVIA
QCDMLELDTEIEYMMELLDPSLLHGEGGYYLTSAYGALSLIKNFQEEQAARLLSSETRDT
LRQWHKRRTTNRTIPSVDDFQNYLRVAFQEVNSGCTGKTLLVRPYVTTEDVCQLCAEKFK
VGDPEEYSLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKRIKNDPYGVIFQN
GEEDLTTS
Download sequence
Identical sequences J9NY33
XP_005634779.1.84170 ENSCAFP00000038200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]