SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9NYS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9NYS2
Domain Number 1 Region: 345-544
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-33
Family Pleckstrin-homology domain (PH domain) 0.0000886
Further Details:      
 
Domain Number 2 Region: 17-189
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-32
Family DBL homology domain (DH-domain) 0.0034
Further Details:      
 
Domain Number 3 Region: 176-293
Classification Level Classification E-value
Superfamily PH domain-like 3.85e-24
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9NYS2
Sequence length 546
Comment (tr|J9NYS2|J9NYS2_CANLF) FYVE, RhoGEF and PH domain containing 5 {ECO:0000313|Ensembl:ENSCAFP00000038441} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=FGD5 OC=Canis.
Sequence
DFHGAVTRALDEIDQEGKDTLSREELRRGLSELPAIRDLHQGILEELGERLLHWEGQQKV
ADVFLAREQEFDHHAAHILQFDRYLSLLSETCLHSPRLAAAVREFEEQQSQQGGGQNVKH
RLLRVVQRLFQYQVLLTDYLNNLCPDSAEYDNTQGALTLISKVTDRANDSMEQGENLQKL
VHIEHSVRGQGDLLQPGREFLKEGTLMKVTGKSRRPRHLFLMSDVLLYTYPQKDGKYRLK
NTLSVASMKVSRPVMEKVPYALKIETPQSCLTLSASSCAERDEWHSCLSRALPEDYKAQA
LAAFHHSVEIRERLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLRRHHCHACGKIVCRN
CSRNKYPLKYLKDRMAKVCDGCYGELKKRQHRNCGSERPVSMSFPLSSPRFSSSAFSSVF
HSINPSTFKKQKKVPSALTEVAASGEGSAISGYLSRCKKGKRHWKKLWFVIKGKVLYTYM
ASEDTVAMESMPLLGFTIAPEKEEGSSEVGPIFHLYHKKTLFYSFKAEDTNSAQRWIEAM
EDASVL
Download sequence
Identical sequences J9NYS2
ENSCAFP00000038441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]