SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9NYT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9NYT0
Domain Number 1 Region: 858-1069
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-55
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 1232-1418
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-26
Family Pleckstrin-homology domain (PH domain) 0.00000889
Further Details:      
 
Domain Number 3 Region: 1058-1178
Classification Level Classification E-value
Superfamily PH domain-like 4.78e-25
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J9NYT0
Sequence length 1422
Comment (tr|J9NYT0|J9NYT0_CANLF) FYVE, RhoGEF and PH domain containing 6 {ECO:0000313|Ensembl:ENSCAFP00000038449} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=FGD6 OC=Canis.
Sequence
MTSAAEIKKPPVAPKPKFVVANKPAPPPVAPKPDIVISGVPQPTKKTKPAIAPKPKVLKG
SSVRDIGQSPSRKIIVNLEEHKQELPENADNSNCKNVGHQSSDYILPVCSCNSQCIHKLG
NRESLFGKQLILEPLEMHENLENSKIDESSSAIKTRSKCDSNVENIKTQTGVVLKANILE
EKLKDVLTQRTSPFISLQKHRSTDNPEMNDGYNSNRQFRIEFADLSPSLSSFEKVPDHHR
CHLQLPNDETYQHTSEKSNTCFHSSEQETLENDGKRSTFLPSGGVSKKSEVKDLGPLEIH
LVPYTPKFPTPKPRKTRAARLLRQKYIDVPSESTEEPGNLDSNSSCLLDAALKNNKISIL
HQNVLCNQERVDKVKPGNKGELNVDSNGDRQHLVNPQKAMHHETSSFEKMETDSNLCSDS
KTVDGSSMSLAVDKGTNFIRCSTLSMSLPKQLKLTCNEHLPTTCNLGVSASQMQKESTIK
GESSSRIVPKKPQRHSLPAAGVLKKAASEELVEKSSYPSNEENNSEKGLERNHLQHLCAQ
NLNMSSSFDMPKRASEKPVWKLPHPILPFSGNPESLKSVTISSNSELSTAMTKPRAKSLS
AMDAERCTKPCKDTQKKNSLKKLLNMKLSICFMKSDFQKFWFKNSQLGDTTTGSLSGGEK
KGIESDWHGMLVEEKRSKPIKAYSADNYSLESQKKRKSRGHTSAANGPRAESLDDQMLSR
ESSSQGPCKSTTSGCAPEYENVRHYEEIPEYENLPFIMAIGKTPELERQNSRSMEDNDAN
VYEVEEPYEAPDGQLQLGPRHQHSSSGASQEGHNDLGLGLGELPSDEEEDINSSDEDDVS
SDSSKGDPDLGDKQDEDTGMKSKVHHIAKEIMSSEKVFVDVLKLLHIDFRDAVAHASRQL
GKPVIEDRILNQILYYLPQLYELNRDLLKELEERMSNWTEQHRIADIFVKKGPYLKMYST
YIKEFDKNIALLDEQCKKNPAFAAVVRDFEMSPRCANLALKHYLLKPVQRIPQYRLLLTD
YLKNLLEDSGDYRDTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYSLNGHHEIVQPGR
VFLKEGTLMKLSRKVMQPRVFFLFNDALLYTTPVQSGMYKLNNMLSLAGMKVRKPTQEAY
QNELKIESVERSFILSASSATERDEWLEAISRSIEEYAKKRITFCPSRSLDEADSENKEE
VSPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSNKYGLDYLKNQ
PARVCEHCFQELQKLDHQHSPKIGSPGNHKSPSSTLSSVLHSIPSGRKQKKIPAALKEVS
ANTEDSSMSGYLYRSKGNKKPWKHLWFVIKNKVLYTYAASEDVAALESQPLLGFTVTQVK
DENSESRVFQLLHKNMLFYVFKADDAHSAQKWIEAFQEGTIL
Download sequence
Identical sequences J9NYT0
ENSCAFP00000038449 XP_854794.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]