SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9NZ64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9NZ64
Domain Number 1 Region: 751-978
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-59
Family DBL homology domain (DH-domain) 0.000000000976
Further Details:      
 
Domain Number 2 Region: 347-523
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.4e-56
Family Regulator of G-protein signaling, RGS 0.0000000351
Further Details:      
 
Domain Number 3 Region: 982-1116
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-42
Family Pleckstrin-homology domain (PH domain) 0.00000036
Further Details:      
 
Domain Number 4 Region: 23-120
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-21
Family PDZ domain 0.024
Further Details:      
 
Weak hits

Sequence:  J9NZ64
Domain Number - Region: 148-158
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00392
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J9NZ64
Sequence length 1539
Comment (tr|J9NZ64|J9NZ64_CANLF) Rho guanine nucleotide exchange factor 11 {ECO:0000313|Ensembl:ENSCAFP00000038584} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=ARHGEF11 OC=Canis.
Sequence
MSVRLPQSIDRLSTLSLGDPAPERRSPSHLRQPSDTSETAGLVQRCVIIQKDQHGFGFTV
SGDRIVLVQSVRPGGAAMRAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLG
SSPLSVGVSGLQQDPAPAGAPRVTPVVPPPPPPPPLPPPQRITGPRPLQDPEFQKHATQI
LRNMLRQEEKELQRICEVYSRNPASPLEEQIEGARRRVTQLQLKIQQEMGGFVVSEAGQA
STVSFPGRLSLDSQEGDSGMDSGTERLPSLSEALMNRNSALSDPGLDSPRTSPVIMARVA
QHHRRQGSDAPGPSTSEQGTDQSPKPLIIGPEEDYDPGYFNNESDIVFQDLEKLKARPAH
LGVFLRYIFSQADPSPLLFYLCAEVYQQTNPKDSRGLGKDIWNIFLEKNAPLRVKVPEML
QAEIDLRLRGSEDIRAALHEAQEAAMPEIQEQIQDYRTKRTLGLGSLYGENDLLDLDGDP
LRERHVAEKQLAALGDILSKYEEDRSAPMDFALNTYMNHAGLRVRDARSSSLAEKAQAAP
DKDKWLPFFPKTKKSSNSKKDKDALEDKRRNPILKYIGKPKSSSQSTFHIPLSPVEVKPG
NVRNIIQHFENNQPYDAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREEMKR
SRKAENVPRSRSDVDMDAAAEAARLHQSASSSASSLSTRSLENPTPPFTPKMGRRSIESP
SLGFCTDALLPHLLEDDLGQLSDLEPEPDTQNWQHTVGKDVVAGLSQREIDRQEVINELF
VTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMRKLREEG
PIIREIGDLMLARFDGPAREELQQVAAQFCSYQSIALGLIKTKQRKESRFQLFMQEAESH
PQCRRLQLRDLIISEMQRLTKYPLLLESVLKHTEGGTSEHEKLCRARDQCREILKYVNEA
VKQTENQHRLEGYQKRLDTTSLERASNPLAAEFKSLDLTARRMVHEGPLTWRISKDKSLD
LHVLLLEDLLVLLQKQDEKLMLKCHSKTAAGTSDNKQTFSPVLKLNAVLIRSVATDKRAF
FIICTSELGPPQIYELVALTSSDKNTWMELLEEAVRNATRHPIAAPVLAHPPPPDAQEPA
HQSPIPTRYSPWRPWSSQPPYTALPSKTGPGPQQRVRGKHPGQLEDPEQESSIEEELGAL
PHPSASLDGESRGGRTRGPILLPLPGPLFMEGLADSALEDVERLRHLILCSLLPGHRSEA
QPTSEPEDDLTPTPSLVSSACHTGDPSSPGRAPHGGEGPEQEDMALCSLERLPPRARNSG
IWESPELDRNPEEEASGTEAAGSYKVVRKGKVVGSRAVTALPESQSGPEPPEVEGGAKAA
GNCFYVSMPAGPPDSTTEPSQPNSLPVWQTEPEPQAQLQGGSGGCRRPSRSPPSMALRDV
GNIFHTIEQLTVKLNRLKDMELAHRELLRSLAGESSGGTTPVGSFHTEAARWTDHSLSPP
AREPLASDSRDSHQPGPCSEDGSNTPLEDGTTHAASSPG
Download sequence
Identical sequences J9NZ64
ENSCAFP00000038584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]