SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9P0T6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9P0T6
Domain Number 1 Region: 116-240
Classification Level Classification E-value
Superfamily PH domain-like 5.32e-19
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 
Domain Number 2 Region: 33-61
Classification Level Classification E-value
Superfamily WW domain 0.0000668
Family WW domain 0.0046
Further Details:      
 
Weak hits

Sequence:  J9P0T6
Domain Number - Region: 5-33
Classification Level Classification E-value
Superfamily WW domain 0.000712
Family WW domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9P0T6
Sequence length 317
Comment (tr|J9P0T6|J9P0T6_CANLF) Uncharacterized protein {ECO:0000313|Ensembl:ENSCAFP00000039159} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN= OC=Canis.
Sequence
EPRPTSPLAAPPGWSCHVSPEGQTLYTNHYTQEQWVRLEDQHGKPYFYNPEDTSVQWELP
QVPVPAPRSICRSNQDSETPAQASPPEEKVREGMREVGNWEKISPPGLLSKIKTLDKAGV
LHRTKTVDKGKRLRKKHWSASWTVLEGGVLTFFKDSKASAAGGLRQPPKLSTPEYTVELR
GASLSWAPKEKSSRKNVLELQSRDGSEYLIQHDSEAIISTWHKAISEGIQEVSADLPPEE
ESQSSGADFGSSERLGSWREDEARLGAGCPGPGAAAAEGDLSKVRHRLRKFLLKRPTLQS
LREKGYIQDQVFGCPLA
Download sequence
Identical sequences J9P0T6
ENSCAFP00000039159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]