SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9P110 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9P110
Domain Number 1 Region: 16-145
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000392
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J9P110
Sequence length 471
Comment (tr|J9P110|J9P110_CANLF) Pleckstrin homology domain containing S1 {ECO:0000313|Ensembl:ENSCAFP00000039233} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=PLEKHS1 OC=Canis.
Sequence
MEPKPQKSPGKRFTFYYENEVCKQDYFIKSPPPQLFFSASSWKKRFFILSKSGERSLCLS
YYKNQHHRGSIKIDRNSSVEVGISSHEKMQSVHKMFKCCSDEVMSIRTTNREYFLIGHDR
EKIKDWVSFVSSFCWDVEAARQDTEEKFSSGDKRPSSDPSPLFDPSSTLEAVTRGCQTPR
NSLPDVHLMGKKSPGLRQAHLPHDFLSETTEDTEEESHYISPQSILSELDSFIASSDSGE
SPEPGSPDQFIERTEHHYMSMKSCFFRETSHESADNKEESQALPEIQNERLHLQEQGSQK
DSCLPPANMEAQTTNDRKELASLTVVQLSILINNIPDEDQVEKLSVFLSPSDIINYLTLT
EAAGRICVAQWQGPPRLGCIFSHGDHLLAVNDLKPQGLDEASLFLSRSVKKEWFFWSERI
LDAVKRQDTCTPMFLAAMSTIAKLWKGPRCPSKDEWIKKMWDVYNGILLSH
Download sequence
Identical sequences J9P110
ENSCAFP00000016445 ENSCAFP00000039233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]