SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9P1R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9P1R0
Domain Number 1 Region: 42-168
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-51
Family Phosphotyrosine-binding domain (PTB) 0.0000688
Further Details:      
 
Domain Number 2 Region: 511-586
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000021
Family SH3-domain 0.00005
Further Details:      
 
Weak hits

Sequence:  J9P1R0
Domain Number - Region: 706-752
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00011
Family Pointed domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J9P1R0
Sequence length 802
Comment (tr|J9P1R0|J9P1R0_CANLF) Epidermal growth factor receptor pathway substrate 8 {ECO:0000313|Ensembl:ENSCAFP00000039485} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=EPS8 OC=Canis.
Sequence
MAMDHHPLFSQMDREHSSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKD
AMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLSTIQHCQAV
MHSCNYDSVLALVCKEPTQNKPDLHLFQCDEIKANLISEDIESAISDSKGGKQKRRPEAL
RMISKADPGIPPPPRAPAPVPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETP
EMMAARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKRKKSKKGKKKGPGEGVLTLR
AKPPPPDEFVDCLQKFKHGFNLLAKLKSHIQNPSATDLVHFLFTPLNMVVQATGGPELAS
SVLSPLLTKDTIDFLNYTVNNDERQLWMSLGETWMKARAEWPKEQFIAPYVPRFRNGWEP
PMLNFMGAPMEQDFYQLAESVANVAEHQRKQETKRLSTEQSSVSEYPPADGYAFNNMYTR
GPQLDQGEAAVAFKPTPNRHMDRNYDPLKGQPKKYAKSKYDFVARNNSELSVLKDDILEI
LDDRKQWWKVRNASGDSGFVPNNILDIVRPPESGLGRADPPYTHTIQKQRMEYGPRPTDT
PSAPSPPPTPAPVPVPLPPSTPAPVSVPKVPANVTRQNSSSSDSGGSIVRDNQRHKQLPV
DRRKSQMEEVQDELIHRLTIGRSAAQKKFHVPRQNVPVVNITYDSTPEDVKTWLQSKGFS
PVTVNSLGVLNGAQLFSLNKDELKTVCPEGSRVFSQITVQKAALEDNSGSSELQEIMRRR
QEKISAAASDSGVESFDEGSSH
Download sequence
Identical sequences J9P1R0
ENSCAFP00000039485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]