SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9P268 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9P268
Domain Number 1 Region: 33-213
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.31e-49
Family CRAL/TRIO domain 0.000000012
Further Details:      
 
Weak hits

Sequence:  J9P268
Domain Number - Region: 9-27
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0863
Family CRAL/TRIO N-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9P268
Sequence length 219
Comment (tr|J9P268|J9P268_CANLF) Alpha tocopherol transfer protein {ECO:0000313|Ensembl:ENSCAFP00000039644} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=TTPA OC=Canis.
Sequence
VVKAPSRSELLKNYYKWRAECPEISADLCPRSILGLLKAGYLGVLRARDPTGSKVLIYRI
AQWDPKVFTAYDVFRVSLITSELIVQEVETQRNGIKAVFDLEGWQFSHAFQITPSVAKKI
AAVLTDSFPLKVRGIHLINEPIIFHAVFSMIKPFLTEKIKERIHMHGNNYKQSLLQHFPD
ILPLEYGGAEFSMEDICQEWTNFIMKSENYLSSISQISE
Download sequence
Identical sequences J9P268
ENSCAFP00000039644 ENSCAFP00000039644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]