SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9P4U6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9P4U6
Domain Number 1 Region: 29-66
Classification Level Classification E-value
Superfamily PH domain-like 0.00000378
Family Pleckstrin-homology domain (PH domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9P4U6
Sequence length 96
Comment (tr|J9P4U6|J9P4U6_CANLF) Uncharacterized protein {ECO:0000313|Ensembl:ENSCAFP00000040619} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN= OC=Canis.
Sequence
RPVGGLRRGRRAVRWDRQTAPSAGFMEDPERKYHFECCSEEQCQEWMGALRRASYEFMRR
SLIFYRNEIQKMTGKDPLEQFGISEEARFQLGGLKA
Download sequence
Identical sequences J9P4U6
ENSCAFP00000040619 ENSCAFP00000040619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]