SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9P657 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9P657
Domain Number 1 Region: 552-663
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.57e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00035
Further Details:      
 
Domain Number 2 Region: 67-238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.26e-28
Family G proteins 0.000000044
Further Details:      
 
Domain Number 3 Region: 342-407,492-535
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000002
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9P657
Sequence length 694
Comment (tr|J9P657|J9P657_CANLF) ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 {ECO:0000313|Ensembl:ENSCAFP00000041139} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=AGAP2 OC=Canis.
Sequence
MHAQRQLAGAAVRAEVRRHEVAKQSLCRLRKLAERVGDPELRNSIQASLDRLHEAVVNSQ
EWTLSRSIPELRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQHKKEMLVDGQTHLVL
IREEAGAPDAKVRGWADAVILVFSLEDENSFQAVSHLHGQLTSLRGEGRGGLALALVGTQ
DRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLL
AACKSLPSSPSHSAASTPVDSFIHPQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAG
LSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDSRGETTGSGRAIPIKQSFLLKRSGNSLN
KEWKKKYVTLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPSAS
INGLVKDMSTVQMGEGPGTKLSHAMNCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPSKT
EGSAGQAEDPEENLEFLIVSSTGQTGHLEAASFEERDPWVQPIESQILASLQCCESSKVK
LRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSR
VRSLDLDDWPRELTLVLTAIGNDVANRVWESDTRGRSKPTRDSSREERESWIRAKYEQLL
FLAPLGAPEEPLGRRLWAAVQAQDVAAVLLLLAH
Download sequence
Identical sequences J9P657
ENSCAFP00000041139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]