SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9P6Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9P6Q8
Domain Number 1 Region: 765-941
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.0004
Further Details:      
 
Domain Number 2 Region: 338-454
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.55e-32
Family Pyk2-associated protein beta ARF-GAP domain 0.0017
Further Details:      
 
Domain Number 3 Region: 103-228
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-25
Family Pleckstrin-homology domain (PH domain) 0.00045
Further Details:      
 
Domain Number 4 Region: 239-346
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000136
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 5 Region: 453-633
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000101
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 6 Region: 648-757
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000247
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 7 Region: 981-1044
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000165
Family Ras-binding domain, RBD 0.075
Further Details:      
 
Domain Number 8 Region: 1024-1119
Classification Level Classification E-value
Superfamily PH domain-like 0.00000899
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9P6Q8
Sequence length 1125
Comment (tr|J9P6Q8|J9P6Q8_CANLF) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 {ECO:0000313|Ensembl:ENSCAFP00000041341} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=ARAP3 OC=Canis.
Sequence
MEMMPNAIYFGLDLRGGVQMTQNTAPDSSQAAAPTPALRPTTGTVHIMDPGCLYYGVQPA
GVPGPLERREGRGVSQDRAEHRLSRQDLEVREDAGYASLELPGDSTLSLPTLDVETNDDL
ISPYASFSSTADRPTPLLSGWLDKLSPQGNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVI
PLTAIEMTRSSKDNKFQVITGQRVFVFRTESEAQRDTWCSTLQSCLREQRLLGHPRPPQP
PRPLRTGMLELRGHKAKVFAALSPGELALYKSEQAFSLGIGICFIELQGCSVRETKSRSF
DLLTPHRCFSFTAESGGARQSWAAALQEAVTETLSDYEVAEKIWSNRANRHCADCGASRP
DWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLDTSVWSNEIVQLFIVLGNDRANRFWA
GALPIGEGVHPDTSPGPRGEFISRKYRLGLFRKPHPQYPDHSRLLQALCAAVAGPNLLKN
MTQLLCVEATEGDEPWSPSALDGSFPGLLIPDPSPGVYNEVVVPATYSSFLYCGPISNKA
GPPPPRRGRDAPPRLWCVLRAALEMFVSESSPEPLSLIQPQDVVCLGVSPPPTDPGDLDR
FPFSFELILTGGRIQHFGTDGADSLEAWTSAVGKWFSPLSCHQLLGPGLLRLGRLWLRSP
THSALAPSLWLSGFGLLRGDHLFLCPAPGPGPPAPEDMVHLRRLQEISVVSAADTPDKKE
HLVLVETGRTLYLQGEGRLDFSAWNTAIEGAAGGGGTGLQEQQMSRGDIPIIVDACISFV
TQHGLQLEGIYRKGGARARSLRLLAEFRRDARSVKLRPGEHFVEDVTDTLKRFFRELDDP
VTSARLLPRWREAAELPQKNQRLEKYKEVIGCLPQVNRRTLATLIGHLYRVQKCASLNQM
CTRNLALLFAPSVFQTDGRGEHEVRVLQELIDDYVSVFDIDSDQVAQIDLEVSLITTWKD
VQLSQAGDLIMEVYIEQQLPDNCVTLKVSPTLTAEELTNQVLEMRGTEAGMDLWVTFEIR
EHGELERPLHPKERVLEQALQWCQLPEPCSASLLLRKVSLAQAGCLFTGIRRESPRVGLL
RCREEPPRLLGNRFQERFFLLRGRCLLLLKEKKSPKPISPLTSAQ
Download sequence
Identical sequences J9P6Q8
ENSCAFP00000041341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]