SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9P856 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9P856
Domain Number 1 Region: 5-120
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-24
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J9P856
Sequence length 524
Comment (tr|J9P856|J9P856_CANLF) GRB2 associated binding protein 3 {ECO:0000313|Ensembl:ENSCAFP00000041923} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=GAB3 OC=Canis.
Sequence
MSAGDAVCTGWLVKSPPERKLQRYAWRKRWFVLRRGRMSGNPDVLEYYRNKHSSKPIRVI
DLSECAVWKHVGPGFVRKEFQNNFVFIVKTTSRTFYLVAKTEVEMLVWVYSISQVCNLGH
LEDGAGAPESLRGKSRADARPTSSRGLGQATGTGSTLQARMPYTLNVTGRRRRSEADFLS
LSYYLVLSTCKSGRTRHASLPSRCDSWPHAERPPEPTSCDDVFVACAPPPRSSPRPDGSA
RAPREPDPAPRTPPPRPPKPSHLSERRQDAQPEGAAASRRVSLSGLDNVRTRRADVEGQS
LRHRDKRLSLNLPRRLSPARPPACAGPGDGYVPMGPQAGARVAGAPCSRDDYMAMSPGSL
CGPLPELPADLEPPPVNRDLKPQRRPRPPPLDLRNLSTIREHASLTRTCTVPCNRTRFLS
PERNGINSARFFADSVSREEEESYIQMENHRTANPLGSGALTWTKKFSLDYLALDFNSAS
PAPVQQKLLLAEEQRVDYVQVDEQKTQALQSTKQEWTDERQSKV
Download sequence
Identical sequences J9P856
ENSCAFP00000041923 ENSCAFP00000041923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]