SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9PAM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9PAM7
Domain Number 1 Region: 625-689,896-1214
Classification Level Classification E-value
Superfamily Ras GEF 3.27e-109
Family Ras GEF 0.000018
Further Details:      
 
Domain Number 2 Region: 224-447
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-43
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 3 Region: 36-132
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000221
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 
Domain Number 4 Region: 435-590
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000209
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9PAM7
Sequence length 1250
Comment (tr|J9PAM7|J9PAM7_CANLF) Ras protein specific guanine nucleotide releasing factor 2 {ECO:0000313|Ensembl:ENSCAFP00000042854} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=RASGRF2 OC=Canis.
Sequence
MQKSVRYNEGHALHLAFLARKEGTKREKMSKRAAEASRWHEKWFALYQNVLFYFEGEQSG
RPAGMYLLEGCSCERTPAPPRAGVGPPGARDALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRIMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIEEPDASDDDS
KGSGQVFGHLDFKIVVEPPDSAPFTVVLLAPSRQEKAAWTSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLAKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLVDGKSPR
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSRIGALDLTTCSASSSPTATHSPAASPP
PHTGKVPLDLSRGLPSPEQSPGSVEEHVDNPRMDLCNKLKRSIQRAVLESVPVDRAGVEG
SPAVDSTDLSPCRSPSTPQHLRYRQPVGQTADNSHCSVSPASAFAIATAAAGHGSPPGFN
NTERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLP
QERKATANILRALSQDDQDDIHLKLEDIIQLTDCPKAECFETLSAMELAEQITLLDHIIF
RSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWV
AVADICRCLHNYNGVLEITSALNRSAIYRLKRTWAKVSKQTKALMDKLQKTVSSEGRFKN
LRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQT
CYRIDHQPKGELCFTRRNSKIQSSWYLSLLHLLVSLGGMKYIDADSEKKN
Download sequence
Identical sequences J9PAM7
ENSCAFP00000036827 ENSCAFP00000042854 XP_013967233.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]