SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9PB52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9PB52
Domain Number 1 Region: 66-166
Classification Level Classification E-value
Superfamily Cyclin-like 6.81e-30
Family Transcription factor IIB (TFIIB), core domain 0.0048
Further Details:      
 
Domain Number 2 Region: 1-64
Classification Level Classification E-value
Superfamily Cyclin-like 3.71e-16
Family Transcription factor IIB (TFIIB), core domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J9PB52
Sequence length 562
Comment (tr|J9PB52|J9PB52_CANLF) BRF1, RNA polymerase III transcription initiation factor subunit {ECO:0000313|Ensembl:ENSCAFP00000043030} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=BRF1 OC=Canis.
Sequence
MAVSKHLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELC
INAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLV
AARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTVDEFMRIDLEGECDPPSYT
AGQRKLRLKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGALATLTRDGSVEDT
TSSLFGEEDPEDEELEAVASHLNKDFYQELLGDSISSSSEVAGGAEGGSRPPALESLLGP
LPTAASLGISDSIRECISSQSQDPTDPCGDGELDLSGIDDLEIDRYILNEAEARVKAELW
MRENAEYLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQASTAGEAIEKMLEQKKI
SSKINYSVLRDLNSKGGGSVPGEDTRAEERASARKLSRRKTPASRSGADPVTSVGKRLRP
MVSAQPAKKAAVGETVLPSPPALGAEAVRPAAVVESGPVSYHPEEDPDEEDPDEEDGEPC
VSALQMMGSNDYGCDGEEDDGY
Download sequence
Identical sequences J9PB52
XP_005623946.1.84170 XP_005623949.1.84170 ENSCAFP00000043030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]