SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9PBL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9PBL7
Domain Number 1 Region: 108-355
Classification Level Classification E-value
Superfamily Kelch motif 9.29e-41
Family Kelch motif 0.023
Further Details:      
 
Domain Number 2 Region: 39-84
Classification Level Classification E-value
Superfamily F-box domain 0.000000000068
Family F-box domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9PBL7
Sequence length 717
Comment (tr|J9PBL7|J9PBL7_CANLF) F-box protein 42 {ECO:0000313|Ensembl:ENSCAFP00000043198} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=FBXO42 OC=Canis.
Sequence
MASSSDSEDDSFMAVDQEEAVLEGTMEQDEDPHPALEAEEMRHNRSMSELPEEVLEYILS
FLSPYQEHKTAALVCKQWYRLIKGVAHQCYHGFIKAVQEGHIQWESRTYPYPGTPITQRF
SHSACYYDANQSMYVFGGCTQSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLV
VYKDLLVLFGGWTRPSPYPLHQPERFFDEIHTYSPSKNWWNCIVTTHGPPPMAGHSSCVI
DDKMIVFGGSLGSRQMSNDVWVLDLEQWAWSKPNISGPSPHPRGGQSQIVIDDATILILG
GCGGPNALFKDAWLLHMHSGPWAWQPLKVENEDHGAPELWCHPACRVGQCVVVFSQAPSG
RAPLSPSLNSRPSPISATPPALVPETREYRSQSPVRSMDEAPCVNGRWGTLRPRAQRQTP
SSSREGSLSPARGDGSPILNGGNLSPGTAAIGGSSLDSPVQAVSPSTPSTTEGYDLKMGL
SLASRRGSLPDQKDLRLGSIDLNWDLKPTSSSNHMDGVDNRTVGGSMRHPPEQTNGVHTP
PHVASALAGAVSPGALRRSLEAIKAMSSKGPSASAALSPPLGSSPGSPGSQNLSSGETVP
VPRPGPAQGDGHSLPPIARRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRV
KWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQNVKYYPKTNALYFVRAKR
Download sequence
Identical sequences J9PBL7
XP_852026.1.84170 ENSCAFP00000043198 ENSCAFP00000043198 9615.ENSCAFP00000023428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]