SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9VG04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9VG04
Domain Number 1 Region: 3-76
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000792
Family Glutathione S-transferase (GST), N-terminal domain 0.0035
Further Details:      
 
Weak hits

Sequence:  J9VG04
Domain Number - Region: 200-234
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000621
Family Glutathione S-transferase (GST), C-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9VG04
Sequence length 285
Comment (tr|J9VG04|J9VG04_CRYNH) Uncharacterized protein {ECO:0000313|EMBL:AFR92276.1} KW=Complete proteome; Reference proteome OX=235443 OS=grubii). GN=CNAG_00139 OC=Cryptococcus neoformans species complex.
Sequence
MSDNKIQLYQFEGSVWSNAPKLALEEGGLKKDKDVRWITINLPEGENFEPNYLKINPSGT
VPTLVVGNDTFTDSISAVAEIIKIAPQRPKGKVSSGASIIEEIHSAAIDPNATLLIATDD
EDRKTKINGIPKGFLAGRQKTLDKLAANPPEEFKEFLTKKQADNKQLLEFFIAEPDEQTR
KAHYAQGQQLWNSVGDALRGFITEALTKNNQGPYVGGSEPSEVDFHLITWLARTITNTGV
EPGTNVDQAIKKLQAKTGGGAFDDSIKLYWETWSARESFKTLGIH
Download sequence
Identical sequences A0A226BQ67 J9VG04
CNAG_00139T0 XP_012046556.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]