SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9VHB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9VHB6
Domain Number 1 Region: 111-206
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.91e-18
Family Selenoprotein W-related 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9VHB6
Sequence length 218
Comment (tr|J9VHB6|J9VHB6_CRYNH) Selenoprotein W {ECO:0000313|EMBL:AFR93563.1} KW=Complete proteome; Reference proteome OX=235443 OS=grubii). GN=CNAG_04063 OC=Cryptococcus neoformans species complex.
Sequence
MPENCKDCDQYPTQPASSTAMSRGVIAPECSLPGADVASPLSLSYVSSQTQAQDQTEVQP
RLKVGAGEAKVEGLENKDEGTGTSTPSASASATVAMLAGQGFKAPDLREVKPSVIIEFCD
RCRWAPRATWIQTELFLTFPNPILRSITLMPLNAPETGGRFRVWVDVGKGMGDELAWDRK
TEGGFPELKVLKQRIRNLVQPDMGLGHSDVHGKTGEAK
Download sequence
Identical sequences J9VHB6
XP_012047652.1.45702 CNAG_04063T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]