SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9VHC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9VHC9
Domain Number 1 Region: 34-127
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000836
Family PDI-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J9VHC9
Sequence length 322
Comment (tr|J9VHC9|J9VHC9_CRYNH) Oligosaccharyltransferase complex subunit gamma {ECO:0000313|EMBL:AFR93578.1} KW=Complete proteome; Reference proteome OX=235443 OS=grubii). GN=CNAG_04078 OC=Cryptococcus neoformans species complex.
Sequence
MRSTSLLAAVPFLSSLALAADPAHWSKLASKSRDGVIKLDSKTYEDILALDREYSVTVLL
TAIPAQYKCQPCQVFDPSYSQVADSWARLPKSQRDQHFFARLDFADGQAIYNQLGLTSAP
TVMYHPPLAGPRRNNKLSVVNYDMNRNGLSAPPLHTWVSGLTPSPFELHTPLNPWPFVFV
PLSLIAIGVSAYSLRSILVPLIQSRIVWGTASIILILTFTSGYMWNKIKNAPYVAAGRDG
KVQWIAAGYQNQLGLESQVVGAIYGLLAFSIVALSVLVPAQTSAVKQRVGVYLWLGMLVV
VFSLLMKLFKMKNGGYPFSLLF
Download sequence
Identical sequences J9VHC9
XP_012047662.1.45702 CNAG_04078T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]