SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9VIY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9VIY0
Domain Number 1 Region: 3-224
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.19e-61
Family Glutathione peroxidase-like 0.00000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J9VIY0
Sequence length 233
Comment (tr|J9VIY0|J9VIY0_CRYNH) Thiol-specific antioxidant protein 3 {ECO:0000313|EMBL:AFR94173.1} KW=Complete proteome; Reference proteome OX=235443 OS=grubii). GN=CNAG_06917 OC=Cryptococcus neoformans species complex.
Sequence
MSLRLGDIAPDFEADTTHGRIKFHDWLDGSWAILFSHPDDYTPVCTTELSAVALSYADFA
SRGVKLIGLSANNVASHEGWIKDINALNPDGPGLEFPIIGDEDRTVSELYGMLDKLDKTN
VDKKGIPFTVRTVFVIDPKKQIRLTLAYPASTGRNFPEILRVIDSLQLGDKHRITTPANW
GIPDPKTGQVEERVIVHPSVQGEEVKQLFGDDVQIVYPYLRFTSNPSKKEVKA
Download sequence
Identical sequences J9VIY0 Q7Z9J5
CNAG_06917T0 XP_012048348.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]