SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9VLD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9VLD8
Domain Number 1 Region: 25-119
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.08e-17
Family Txnl5-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9VLD8
Sequence length 119
Comment (tr|J9VLD8|J9VLD8_CRYNH) Uncharacterized protein {ECO:0000313|EMBL:AFR94266.1} KW=Complete proteome; Reference proteome OX=235443 OS=grubii). GN=CNAG_05001 OC=Cryptococcus neoformans species complex.
Sequence
MPLQTAPYPHVFNALNGPTAPAVSYIVFYSNIVDGQMWCPDCRAVENVVKETFDTPDKPN
AAIFWVGNRQEWRTPNNQARTEWNVNSVPTILRLENGKETGRLVEDEILDKARLQAFIK
Download sequence
Identical sequences J9VLD8
XP_012048651.1.45702 CNAG_05001T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]