SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9VLH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9VLH6
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.47e-32
Family DsbA-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J9VLH6
Sequence length 245
Comment (tr|J9VLH6|J9VLH6_CRYNH) Uncharacterized protein {ECO:0000313|EMBL:AFR95337.1} KW=Complete proteome; Reference proteome OX=235443 OS=grubii). GN=CNAG_02496 OC=Cryptococcus neoformans species complex.
Sequence
MKIDITSDVICPFCLIGVKQLLAAIDKYKVTHPDAEFNIRFLPYELNSNLTEEPIPRKQF
YITKFGEEKAAQILSMLPAKYEAVGCKCDLSGDISSTQLAHRLQTYALCHRPSAQLPLVL
DIFTGFHSEAKHPSDKQWLTSLAVKHGVFPDEKAAREWLDGKQCDKEVKKAYGTARDLGV
TGVPFFVFQDKYAASGAMGTEEFVRLLEEIDQREKVFSEKSAPALKGGETCTDEGPYPFV
GNNGC
Download sequence
Identical sequences J9VLH6
CNAG_02496T0 XP_012050182.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]