SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9VLS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9VLS0
Domain Number 1 Region: 4-75
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000824
Family Glutathione S-transferase (GST), N-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 160-236
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000156
Family Glutathione S-transferase (GST), C-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J9VLS0
Sequence length 249
Comment (tr|J9VLS0|J9VLS0_CRYNH) Glutathione transferase {ECO:0000313|EMBL:AFR95208.1} KW=Complete proteome; Reference proteome OX=235443 OS=grubii). GN=CNAG_00921 OC=Cryptococcus neoformans species complex.
Sequence
MPHQIILHHLNNSRSDRIFWTLEELNLPYDVQVHFRLPTRSAPPSLHKVSPLGRAPALIL
DGRLLTESAYIIHTLLSLPEVQQAAQKGEIDVQVENTNDDVFWSHFAEASMMNLLQGMAT
VGATSQGWLSGKVPGLPELSEDEKKGIQKYSSWVQDGYFRPNIQSPIDFAENFLAKQDAP
FFSGTSKPGEGDFMMFFAINSLLGGSRADMGFKVGPNLKKWYDIVLSRPAGKKALERLKQ
EEESAKAKI
Download sequence
Identical sequences J9VLS0
XP_012049194.1.45702 CNAG_00921T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]