SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9VP64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9VP64
Domain Number 1 Region: 7-222
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.78e-32
Family Phosducin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9VP64
Sequence length 287
Comment (tr|J9VP64|J9VP64_CRYNH) GTPase inhibitor {ECO:0000313|EMBL:AFR96038.1} KW=Complete proteome; Reference proteome OX=235443 OS=grubii). GN=CNAG_05720 OC=Cryptococcus neoformans species complex.
Sequence
MVNPDEDTEFNDALRRHGILPPKPPSRSPSPDIPHITHTDAVRAVAATADADQLVTLIEG
DNVDSDDERMFEEYKRKRLHEMKKEEKKGRFGSMEPLGREDFVKEVTEGSKADPDGEQIE
DQDDDDEESSPRLKGTGVVVFLFKDSVPLSQHLRPLLNQAAAAHPSTKFLSIPAGLCIPN
YPDKNVPTLLIYRNGEMIGNVVAGMGLKGMKTTVRDLEGLLLYFKAVEKPSAALLRSSEA
IERLDSDDDFNDDVGTVNTRGGGLRTGGVDIGAGRGKEDSDDSDFDM
Download sequence
Identical sequences J9VP64
XP_012050471.1.45702 CNAG_05720T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]