SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9VPY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9VPY2
Domain Number 1 Region: 24-132
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.42e-27
Family PDI-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J9VPY2
Sequence length 388
Comment (tr|J9VPY2|J9VPY2_CRYNH) Protein disulfide-isomerase {ECO:0000313|EMBL:AFR93765.1} KW=Complete proteome; Reference proteome OX=235443 OS=grubii). GN=CNAG_02927 OC=Cryptococcus neoformans species complex.
Sequence
MKLDWFAVITAVLLPLSAYAGMYSQPVLHLDSKTFKSVMANEHAAMVAFVAPWCGHCKNL
GPEYTAAAQSLSPLIPFYAVDCDESSNRGLCAEYGVQGYPTIKGFPKAGKGAAKEYNGER
KRGALVEYAKGLVPERVKKLRVQGDIQSDVQGFLGEKSELPHVLLVHPSSPSIPFLWKVL
AHRFSNKLHLGYVRDTTSHDVLSLLGIYDSADTTRDSTRVVAWSPGSQRGEFVEYDGILK
FNALLEWLQTTFTSAAPSNTKQRPIKAPQPTVKSTNKEKEQIPTQAQNDAAARRAKLEEM
ERRDKARREKAAEAARAQAMATEPEPETEKEATPVEDAADAAPAQVIEDASLPMEEVESK
PVPEEAPDDEASARDVEVEKTEVVHEEL
Download sequence
Identical sequences J9VPY2
XP_012048225.1.45702 CNAG_02927T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]