SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9VR95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9VR95
Domain Number 1 Region: 26-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.68e-16
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J9VR95
Sequence length 150
Comment (tr|J9VR95|J9VR95_CRYNH) Uncharacterized protein {ECO:0000313|EMBL:AFR96967.1} KW=Complete proteome; Reference proteome OX=235443 OS=grubii). GN=CNAG_04235 OC=Cryptococcus neoformans species complex.
Sequence
MPRLVPPFSSFPKTQPVQGYKHFLTPLRKLIFDYDAEAPSQHGIRSYIRKPLLDMARENP
DVEIVVRRLKRGKAAVLRGHYVNGRDKVICVNKLEANEVANKVDLLLNSSGAKIKHLKNL
TLEAAPGAESARGIWSALHDKTRDGKGYQI
Download sequence
Identical sequences J9VR95
CNAG_04235T0 XP_012051681.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]