SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9VVN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9VVN8
Domain Number 1 Region: 13-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.91e-46
Family Glutathione peroxidase-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9VVN8
Sequence length 151
Comment (tr|J9VVN8|J9VVN8_CRYNH) Glutathione peroxidase {ECO:0000256|RuleBase:RU000499} KW=Complete proteome; Reference proteome OX=235443 OS=grubii). GN=CNAG_06287 OC=Cryptococcus neoformans species complex.
Sequence
MSDIYSYSVEFPKSTLPLSDLKGKTLLFVNVASKCGLTPQYKDLQALHEKYGDKGLAIIG
FPCNQFKAQEPGTDDEVLQFCQLNYGVTFPIAKKGDVNGENTQPIWKYLKENAEPPVSDI
DWNFSKFLVKDGKITWFPARSTKVSDVEAAL
Download sequence
Identical sequences A0A0D0VD14 A0A225XGB6 A0A226BA74 J9VVN8
CNAG_06287T0 XP_012053381.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]