SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9VW59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9VW59
Domain Number 1 Region: 12-167
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.24e-31
Family Phosducin 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J9VW59
Sequence length 226
Comment (tr|J9VW59|J9VW59_CRYNH) GTPase inhibitor {ECO:0000313|EMBL:AFR96859.1} KW=Complete proteome; Reference proteome OX=235443 OS=grubii). GN=CNAG_04128 OC=Cryptococcus neoformans species complex.
Sequence
MSRSPSPTLSDSALLDSLEDSFDYSAHREARMEALSRQIKQVKDLRESEYGRIVEFNEEK
ALIERMAKEKYCILHFVHPNFKRCDIMDRHLSQLASKHKHTLFLRANVDNVPFLVTKMAV
KVLPCVMSYVDGRAVDRLIGFEELGQSDNFTTKALEFRLSQTGVLPTDLTLATNVSASIL
THKQQGSRPGSEGEDSEEERDRRRGKSGIRSGFRNKRGGESGDDDW
Download sequence
Identical sequences J9VW59
CNAG_04128T0 XP_012051603.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]