SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9VWM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9VWM2
Domain Number 1 Region: 30-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.96e-27
Family Thioltransferase 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9VWM2
Sequence length 138
Comment (tr|J9VWM2|J9VWM2_CRYNH) Thioredoxin {ECO:0000256|PIRNR:PIRNR000077} KW=Complete proteome; Reference proteome OX=235443 OS=grubii). GN=CNAG_01607 OC=Cryptococcus neoformans species complex.
Sequence
MLGQLSRSVRLSVAPLRTTLIQRAFHASPISRDHIIDASDEVFEKRALDAGNSRPVLVDF
YASWCQPCRVLTPLLKRVTGPESNYDLLTINVDEYPEVAAKYKVSALPTVVAFKNGAVKN
KFVGFRGQDDINKFLGML
Download sequence
Identical sequences J9VWM2
CNAG_01607T0 XP_012052636.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]