SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9W1V7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9W1V7
Domain Number 1 Region: 171-309
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.57e-32
Family Glutathione S-transferase (GST), C-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 30-86,129-165
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000016
Family Glutathione S-transferase (GST), N-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9W1V7
Sequence length 330
Comment (tr|J9W1V7|J9W1V7_CRYNH) Glutathione S-transferase {ECO:0000313|EMBL:AFR98085.1} KW=Complete proteome; Reference proteome OX=235443 OS=grubii). GN=CNAG_01889 OC=Cryptococcus neoformans species complex.
Sequence
MPTSANRIHNNADEKGNFNRQVSSFRDAIQPGGQFPPEKGRYHLYVAFGCPWAHRSLIVR
RLKGLEDFIDISIVHPHLHEGGWHFVTPEAAAHPAPVSEHPDTSFPGATQDHLFGFSHLS
KIYYKANPDYNARFTVPVVWDKITGTIVNNESSEVIRFFNSAFNELLPEGKGKDLDLYPE
ELRGEIDELNEWVYHDINNGVYKTGFATTQEAYEKAVIPLGKALERINERLSDGREFLVG
GRLTEADVRLYTTIVRYDPVYHSHFKCNTGLIRHDYPHINRWLKNLYWNYPAFKDTTNFD
HIKDGYWYSQINLNPTRIVPIGPKHNVEPL
Download sequence
Identical sequences J9W1V7
CNAG_01889T0 XP_012052829.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]