SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K0B4Y5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K0B4Y5
Domain Number - Region: 4-29
Classification Level Classification E-value
Superfamily RING/U-box 0.00138
Family RING finger domain, C3HC4 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K0B4Y5
Sequence length 57
Comment (tr|K0B4Y5|K0B4Y5_9ARCH) Uncharacterized protein {ECO:0000313|EMBL:AFS79945.1} KW=Complete proteome OX=1229908 OS=Candidatus Nitrosopumilus koreensis AR1. GN=NKOR_00095 OC=Nitrosopumilus.
Sequence
MDAKCPECEKVAILDDKITNVRCPHCNFEADYDTYIEIMKDQAINMSSEYIPDRPGL
Download sequence
Identical sequences K0B4Y5
WP_014962338.1.70052 WP_014962338.1.82955 gi|407461570|ref|YP_006772887.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]