SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K0B802 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K0B802
Domain Number 1 Region: 9-113
Classification Level Classification E-value
Superfamily Prefoldin 4.45e-22
Family Prefoldin 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K0B802
Sequence length 133
Comment (tr|K0B802|K0B802_9ARCH) GimC subunit beta {ECO:0000256|HAMAP-Rule:MF_00307} KW=Complete proteome OX=1229909 OS=Candidatus Nitrosopumilus sediminis. GN=NSED_02265 OC=Nitrosopumilus.
Sequence
MSSGQMPPWLQEQLMKLQQSQQSLQSIMTQKQHLEIEKAETEKALEELKKVADGDAVFKQ
AGTVLIKSKKQELIDELEERIEMTKTRSTVLEKQETRLKETLKEQETKITEMMKGGSANA
PPKSPPAEDNPRK
Download sequence
Identical sequences K0B802
gi|407464323|ref|YP_006775205.1| WP_014964635.1.40567 WP_014964635.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]