SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K0BB86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K0BB86
Domain Number 1 Region: 8-172,200-217
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-46
Family Ribonuclease PH domain 1-like 0.00000682
Further Details:      
 
Domain Number 2 Region: 186-270
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.15e-23
Family Ribonuclease PH domain 2-like 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K0BB86
Sequence length 272
Comment (tr|K0BB86|K0BB86_9ARCH) Exosome complex component Rrp42 {ECO:0000256|HAMAP-Rule:MF_00622} KW=Complete proteome OX=1229909 OS=Candidatus Nitrosopumilus sediminis. GN=NSED_02250 OC=Nitrosopumilus.
Sequence
MTSTSVIDELKRTQILELLEQGKRVDGRALDEAREIKIETNAIPKANGSARVFLGDTEVI
CGVKIQPDRPFPDTGDKGLFICTAELLPLSHPTVETGPPQPPVIELARVVDRGIRESHMV
DVSQLVIEKDKSVIGVFADNVVVDYDGNLFDACSYAATAALLTTKTPKWNWTDDSPVLAE
GEDRPLPITTIPVSVTMGKIGNYIVVDPNGDEWESMDARVTITTDSDGNICALQKGGSDG
FTQDEINQCGEISVRIGAKIREKLKAAQKDSQ
Download sequence
Identical sequences K0BB86
gi|407464320|ref|YP_006775202.1| WP_014964632.1.40567 WP_014964632.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]