SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K0BDR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K0BDR1
Domain Number - Region: 89-120
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00027
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Domain Number - Region: 35-88
Classification Level Classification E-value
Superfamily POZ domain 0.0549
Family BTB/POZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K0BDR1
Sequence length 122
Comment (tr|K0BDR1|K0BDR1_9ARCH) Zinc finger C2H2-type domain-containing protein {ECO:0000313|EMBL:AFS82461.1} KW=Complete proteome OX=1229909 OS=Candidatus Nitrosopumilus sediminis. GN=NSED_03275 OC=Nitrosopumilus.
Sequence
MLTIDCRDILSIKNDLLVYVADQVAAIPTLKNHQFTLSSFDDEIIDVSEVISAIKEYLDS
IDEGRNFAVISNNDVINITSISGKVIERTTTQSEHEMFSCTHCGFVTQYQVELNAHMRIH
YI
Download sequence
Identical sequences K0BDR1
gi|407464521|ref|YP_006775403.1| WP_014964833.1.40567 WP_014964833.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]