SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K0BEB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K0BEB1
Domain Number - Region: 6-44
Classification Level Classification E-value
Superfamily RING/U-box 0.00483
Family ZZ domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K0BEB1
Sequence length 55
Comment (tr|K0BEB1|K0BEB1_9ARCH) Uncharacterized protein {ECO:0000313|EMBL:AFS83365.1} KW=Complete proteome OX=1229909 OS=Candidatus Nitrosopumilus sediminis. GN=NSED_07865 OC=Nitrosopumilus.
Sequence
MGKKEKCVICSEIVGFRFKAMEEWGIEGTLCGKCYSKKIDEHYPGDHVRVNKHLD
Download sequence
Identical sequences K0BEB1
gi|407465425|ref|YP_006776307.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]