SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K0BF12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K0BF12
Domain Number - Region: 34-61
Classification Level Classification E-value
Superfamily RING/U-box 0.00971
Family RING finger domain, C3HC4 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K0BF12
Sequence length 63
Comment (tr|K0BF12|K0BF12_9ARCH) Uncharacterized protein {ECO:0000313|EMBL:AFS83645.1} KW=Complete proteome OX=1229909 OS=Candidatus Nitrosopumilus sediminis. GN=NSED_09275 OC=Nitrosopumilus.
Sequence
MKIECGCHCIKCKSTDLESNRIGEIEKDGYYDMHHTCKKCNTHFDHLDGEVFLTCEKCSY
SSS
Download sequence
Identical sequences K0BF12
WP_014966010.1.40567 WP_014966010.1.82955 gi|407465705|ref|YP_006776587.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]