SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K1Q9E3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K1Q9E3
Domain Number 1 Region: 11-87
Classification Level Classification E-value
Superfamily HMG-box 9.95e-24
Family HMG-box 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K1Q9E3
Sequence length 122
Comment (tr|K1Q9E3|K1Q9E3_CRAGI) HMG box transcription factor BBX {ECO:0000313|EMBL:EKC27954.1} KW=Complete proteome; Reference proteome OX=29159 OS=Crassostrea gigas (Pacific oyster) (Crassostrea angulata). GN=CGI_10018417 OC=Ostreoida; Ostreoidea; Ostreidae; Crassostrea.
Sequence
MDPADPDKKEVRRPMNAFLIFCKRHRSMVREKNPNLDNRNVTRILGDLWANLKEDEKMQY
TDLAKQYKDAFMKANPDYKWHNPEKGMHPTGLLPRSPTKEGLDFTRADQTITPGKLAGKF
VC
Download sequence
Identical sequences K1Q9E3
EKC27954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]