SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K1QCB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K1QCB8
Domain Number 1 Region: 87-125
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000859
Family Ovomucoid domain III-like 0.0075
Further Details:      
 
Domain Number 2 Region: 50-88
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000152
Family Ovomucoid domain III-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K1QCB8
Sequence length 256
Comment (tr|K1QCB8|K1QCB8_CRAGI) UPF0464 protein C15orf44 {ECO:0000313|EMBL:EKC26440.1} KW=Complete proteome; Reference proteome OX=29159 OS=Crassostrea gigas (Pacific oyster) (Crassostrea angulata). GN=CGI_10008161 OC=Ostreoida; Ostreoidea; Ostreidae; Crassostrea.
Sequence
MSKRVERTMQFFFTLVLVLATWCGLHCQHLDDLRQRDGGMGRVGGGLCGSCRRTYRPVCG
VDEETYLNNCFARCSRVPVQCYKRCPCSSNSACDRCPVHYSPVCGTDEQTYDNQCFAQCR
TVSSREPVSWIGNIKNLAPISDFVEPPYGEDDNKTPFPIRPAEKHSYAQSCVVWIKPSGL
QELNRLRRAALSFGFHDLFEAMASMLDRECTMLPGSAHPDAALQLTHAANVLRSEMATDI
AQVILPLRTNFNQDTT
Download sequence
Identical sequences K1QCB8
EKC26440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]