SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K1QCY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K1QCY2
Domain Number 1 Region: 35-134
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000235
Family Pentapeptide repeats 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K1QCY2
Sequence length 229
Comment (tr|K1QCY2|K1QCY2_CRAGI) Periaxin {ECO:0000313|EMBL:EKC34767.1} KW=Complete proteome; Reference proteome OX=29159 OS=Crassostrea gigas (Pacific oyster) (Crassostrea angulata). GN=CGI_10009569 OC=Ostreoida; Ostreoidea; Ostreidae; Crassostrea.
Sequence
MSKKTRIMQSFWLVVVTIAVIHQCFSKTLDDVKLSHFFEEKLRFPKIKLPKVKLPSVNLQ
NIKIPDIDFKKMSLPKVDFSKIQIPNINLPSFDLSSIQIPSVTIPKMDFGNIQIPEFRIP
SVKLPKISFPKIDLVCGSQYVNSMKSRQAYLDKLKLLNSALESDFVYNVTFDEKSLNFLE
MSVNLISIDYRLSNSTARTYNATGEKFYLIDMIRSAEVLAPKLFQDFLN
Download sequence
Identical sequences K1QCY2
EKC34767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]