SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K1QD03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K1QD03
Domain Number 1 Region: 58-300
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.88e-59
Family Ankyrin repeat 0.00016
Further Details:      
 
Domain Number 2 Region: 226-491
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.21e-52
Family Ankyrin repeat 0.0003
Further Details:      
 
Domain Number 3 Region: 504-607
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000795
Family Ankyrin repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 614-655
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000288
Family SOCS box-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K1QD03
Sequence length 688
Comment (tr|K1QD03|K1QD03_CRAGI) Ankyrin repeat domain-containing protein 50 {ECO:0000313|EMBL:EKC28974.1} KW=Complete proteome; Reference proteome OX=29159 OS=Crassostrea gigas (Pacific oyster) (Crassostrea angulata). GN=CGI_10011848 OC=Ostreoida; Ostreoidea; Ostreidae; Crassostrea.
Sequence
MAEEEELRIRDRSQDKSRSGFEKREKRRRIRKLQDAIIQKDRVKIQELLEEDFEVDFQYR
GQTALQLAVKEGEYEICQKLVEKGADVNVCDAQKNSVLNTACWKGHTDIVKLLVRSGAQL
NAQNDHESTPLFTAAYKGYFDIVSVLVEACCDLDLQNVHGQSPLHAAVKNEHISCVHRLV
DGGCNINFIDTDFKSPLMVASELGLTEVAKILLEKGASVNLKDRTGETAVLLAAAQGHSD
IIKELAYHKADVDMATTNGRVPLIEAIIGSHWKTATALIQAAADVNRKDKQQQAPIHAAI
RQVSSVFGREFDQQAMAIVKELINRGADINKQDSQGWTALYQSAFAGNLELSTLLLDQKA
DVSITTTSGDSVLHAGVYGNNATIVDHLIAAGCDVNKVNKKGEHPLFSAILSRVDIKIVR
ALIEAGSNLDLKEKTVQLTSLHEAIIQHYTEAALLLIESGCDINARNGKEQTPLYTACEK
GNTQVVERLLSLPEVNTRGAKVSTIPIHVATANNFSHIVQQLIDVNCDFHVMNEKGMTPI
MVATNENSTRVAKVLIKNGCDLESHCREKKLMVCCVLYQDSHPHFDLEPLFLALTHKNIE
LIKLYLMCYRKIPVKFPRSLQEICRCHIRECVKQPFLKNVPKLPVAKKIMDFITMEDILS
LSSEAEEEEELRHAGKFTFVGRKMPYEL
Download sequence
Identical sequences K1QD03
EKC28974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]