SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K1QD68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K1QD68
Domain Number 1 Region: 137-395
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.16e-48
Family Ankyrin repeat 0.00021
Further Details:      
 
Domain Number 2 Region: 461-503
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000471
Family SOCS box-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K1QD68
Sequence length 587
Comment (tr|K1QD68|K1QD68_CRAGI) Uncharacterized protein {ECO:0000313|EMBL:EKC19456.1} KW=Complete proteome; Reference proteome OX=29159 OS=Crassostrea gigas (Pacific oyster) (Crassostrea angulata). GN=CGI_10008506 OC=Ostreoida; Ostreoidea; Ostreidae; Crassostrea.
Sequence
MAASAATSHTTCTTRMTTDSGRYRVSNWGLRSQNMIDKRPQSSRGGRVRSAGASRRGPPK
MGKTKMTNGTTKPTINKDPLAIPRPHVPEKQSLKSQPRPPDVSLESPPNPELQRILKENP
DIPPATRDFFDFMVERRYDQVKKMLKERLVDVNSRDTDNRLLPTPLLIATELNDVELVKL
LLKAKPKPANVNDENIKGRRPIWWAARWANEEMTDLLLNSSKQKCEVNFVDKETGCAPLY
RAILSNAANIVQLLIHAGADINLRIMGLDVGAETPLIKAIQKDNREICELLINSLCKLQA
KTTSGLNALHYAVAYRRYEICELLLENGIKINSKTPSGVTAMAVAVEQQIPAMVKLLLDY
GYRIDKRYKWKETPLQHAISIHSEECAVTLIHYGCSIVPEGKWKGPSYFSMAVNEKQMKV
VRFMVAIKPTLLNEKWLQKKKWPVSIYRRPDIVEWLEKKCQKVQSLKELSRGRIFQYLGK
FGIKKIESLQLPDAMKEYLRYNEFIKEKYYVRKKLDLKCCPFECPSYCANKRCLPIEISS
SEEDSEASSSEEETSDRGNYCKICMIRHPSDMTDNLHHQPIGYSGRK
Download sequence
Identical sequences K1QD68
XP_011429171.2.10878 EKC19456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]