SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K1VM77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K1VM77
Domain Number 1 Region: 208-383
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.46e-25
Family Glutathione peroxidase-like 0.0022
Further Details:      
 
Domain Number 2 Region: 89-169
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.98e-18
Family FAD-linked reductases, N-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 14-84
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000000000628
Family PHBH-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K1VM77
Sequence length 384
Comment (tr|K1VM77|K1VM77_TRIAC) Uncharacterized protein {ECO:0000313|EMBL:EKD00467.1} KW=Complete proteome; Reference proteome OX=1220162 OS=Trichosporon asahii var. asahii (strain CBS 8904) (Yeast). GN=A1Q2_05304 OC=Tremellomycetes; Trichosporonales; Trichosporonaceae; Trichosporon.
Sequence
MRGCTVYRDGGINIFQRHGHSVVLLPREADMVRIYVPLGTSGEPFDRKSVSCEKLIAILK
EWLSPHRVNIDYVDWWTVYEVAQRCTPSMEAHSGRVLIAGDACHTHSPKAGQGMNVSMLD
GFNLGWKLAGVLKGTHNPDVVRTYSPERHQVAAQLIAFDKLWSSYFTGQRKVEPGEFERT
FRQSMKWMSGTAVLYETGLIVATEDECDPHRANGVSVGSHFENATVKLVFNSMEAQLQTR
MRANGRWKVVCDVLQAAIQEELSEYTDGLTNFVKRFTRVGDDLDSVLEVVTVFRSPHSDV
QNTTNSFSDVLRPRRTVYGVKQGYTARDTLFTDAEGAAYKQYGVDGPASVLVRPDQHVAG
VFEMSEAGLQKMDKFLSRVLVPVQ
Download sequence
Identical sequences K1VM77

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]