SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K1XGA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K1XGA5
Domain Number 1 Region: 395-495
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.45e-22
Family Flavin-binding PAS domain 0.038
Further Details:      
 
Domain Number 2 Region: 331-379
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000379
Family HAMP domain 0.013
Further Details:      
 
Domain Number 3 Region: 562-769
Classification Level Classification E-value
Superfamily PP2C-like 0.0000994
Family PP2C-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K1XGA5
Sequence length 771
Comment (tr|K1XGA5|K1XGA5_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:EKD29275.1} OX=717931 OS=groundwater metagenome. GN=ACD_78C00458G0002 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MQIKTKLPLYYAAIGVIVILWLGYVFRNGEGLITSNIKNQFLSNGENTSLEIDKFLYERL
VSLNTLSTNTALQDSVVNFSTSKLSSSENLRKALEDFLLINKTFYSAEILDANGIVLEWN
EILERENVDKAYIVREAILKDIGTNKSGETFFKRVKDSKDYVIDTPQKDSEWNIFLSFVV
PVLKNMGNEGNIEVVGMIKAKLSIEHIAKIFADISVGSTGKAYIYTTTGDIVASFDRRDI
LTKFTWKKWDITLYKEKALIQEEDNSWVKVLAVYKLMDGYKKYKGLGWSIKITQEYNELF
SALDGIKNTAYATIVFVIFSVLFLAAAIQWQFINPLSRLLAKVRTFSAGDENVYIDVESK
DEIGVLAGAFNDMIFKIKEKTKILSEYKNIIDSTALVSKIDIDGNFIYVNDIFCNNAGCE
LQEIIGKPHKAIRHSDITEDTFKDIEKTMKAKEIWKGIMKNVRKDGSEYWLQSVIAPILD
MNNNIVEMIMMETDITELEKTKHELLSSYNKLQESTDALVVKERISKEFELAGKIQEDFM
PAPEDMEVEWVEVHCGITSATEIGGDLYDIITRKNNPDQTLFYIGDVTGHGLIAGIMMAI
CNSLTYILAQNAENSIKDILIKLNETLFHKLPKKVFITFLLLEYNARSGALSYAGAGHDN
FLVYRKESDMVEEIKTGGSAIGMFQNITNDVKVNDLPLGTGDVVLMYTDGIPEARNKDGE
FYGMERFRESFKSNAHRSVQAMYEGILKDLHDFIAWAEILDDITMFLIRKK
Download sequence
Identical sequences K1XGA5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]