SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K2QYP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K2QYP8
Domain Number 1 Region: 213-398
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.05e-52
Family Glutathione peroxidase-like 0.0001
Further Details:      
 
Domain Number 2 Region: 3-97
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.49e-28
Family PHBH-like 0.0004
Further Details:      
 
Domain Number 3 Region: 91-181
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.64e-18
Family FAD-linked reductases, N-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K2QYP8
Sequence length 413
Comment (tr|K2QYP8|K2QYP8_MACPH) Monooxygenase FAD-binding protein {ECO:0000313|EMBL:EKG15051.1} KW=Complete proteome; Reference proteome OX=1126212 OS=Macrophomina phaseolina (strain MS6) (Charcoal rot fungus). GN=MPH_07734 OC=Botryosphaeriaceae; Macrophomina.
Sequence
MVGDSSDTIWGVMDVYPRTDFPDIRKKAIIRSHAGSLIIIPREGGSLVRFYIELPHGVAA
KDVKVANLHEAARQIFQPYRMEFAETSWWSAYAIGQRLADRFTQSSRVFLTGDACHTHSP
KAGQGMNVSLQDGYNIGWKLGSVLSGQTHPSIINTYVTERYKVAAGLIAFDRSFSRLFKT
GKDAPTPEHVSEQFIMAGRYMAGLTARYDDSAIIDSKGSAENLAKNVTVGMRLPSVQVVR
FCDAKSMQLAKALPADGRWRLVVFPGEIADPATMVKLQELAHFLGGKQGLVPKFTRSGSD
VDSFIEAIVVLKGNRLSIEQDQIPEYFWPVTGKWRMRDLHKVYVDDEDYKNIHGRAYQHL
GVDPSKGALIIVRPDQYIAATYPLSDVRSVENFFAHFGATSLQSSSERVSERL
Download sequence
Identical sequences K2QYP8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]