SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K2S978 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K2S978
Domain Number 1 Region: 225-349
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000105
Family Glutathione peroxidase-like 0.0029
Further Details:      
 
Domain Number 2 Region: 3-101
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000000000000129
Family PHBH-like 0.0034
Further Details:      
 
Domain Number 3 Region: 95-179
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000311
Family FAD-linked reductases, N-terminal domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K2S978
Sequence length 350
Comment (tr|K2S978|K2S978_MACPH) Monooxygenase FAD-binding protein {ECO:0000313|EMBL:EKG18959.1} KW=Complete proteome; Reference proteome OX=1126212 OS=Macrophomina phaseolina (strain MS6) (Charcoal rot fungus). GN=MPH_03775 OC=Botryosphaeriaceae; Macrophomina.
Sequence
MEGDKTAFKWVRMDGKFATNMPNPNVGTASIETDTHGNVLWVALDHDAHRIGYVLSPKLY
EKYGDNITEEQAKHEAVQAMKPFSLEIERLDWMTCYGIGQRVAERFHFNDYVLLARDAGQ
THSSGVAQGMNTGVHDATNLSWKLAGTVKGWYKPSVLQTYEDERRPSAQKLIEIDKSLAA
NSTPDEVLAMIMEETVPFTVGLGINYTKTALNNRCSKPGAQIGRIRLYEANKAAGRWTIL
VFAGNTALTAPSFARLREALALETSFAKRYAHIVDLITIVPGIAYSAWTALEGPAIGKML
LDPDFQAHERYGVLHESGAIVVLRPDTVLGFAADFDCVEEVDKYFTEICT
Download sequence
Identical sequences K2S978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]