SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3W5A8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3W5A8
Domain Number 1 Region: 197-302
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.42e-25
Family Canonical RBD 0.0014
Further Details:      
 
Domain Number 2 Region: 90-196
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.99e-25
Family Canonical RBD 0.0014
Further Details:      
 
Domain Number 3 Region: 3-74
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000148
Family Canonical RBD 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3W5A8
Sequence length 413
Comment (tr|K3W5A8|K3W5A8_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T000149} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MDAECKTLWMGDIQMHWDEAFISSLFAATGEQPVVKLIRDKVTGYPAGYGFLEFPTQRGA
QLVLETYNGQVIPNTLHRFRMNWGAGGRRIETGDDHSVFVGDLAPDVSDELLLTTFSTRF
SSVRGAKVVIDPVTRMSKGFGFVRFGNKEEADQALQTMNGVYCSSRPMRVSVATDRNGKP
RSGNQVYGAGGMGNTEEEGANTTVFVGGLDPSTTEEELRARFGAIGDIVSVKVPPGRGCG
FVQYTTKEAAEVAIGQMNGTVIGGVKVRCAWGRSAAVRAAAAAGGAGGYYQQYPNYQQSG
YQNYYGYGGYYPQYQQVGGYGGYGGYGSYDQQGSQQHGGYQQHGHGHQSHHGGHHGHHRH
QEPRDFTRPDDIDAMNRRYASQRAYQHMPPAANASYSSMSSDVTKGTAMAGSM
Download sequence
Identical sequences K3W5A8
PYU1_T000149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]