SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3W5B4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3W5B4
Domain Number 1 Region: 116-225
Classification Level Classification E-value
Superfamily Bet v1-like 0.00000000522
Family STAR domain 0.027
Further Details:      
 
Domain Number 2 Region: 245-310
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000921
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3W5B4
Sequence length 452
Comment (tr|K3W5B4|K3W5B4_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T000155} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MFEPSLAATTDQYSIRFAPDPLRDLEREKLVTLGHREFADLFATIRFARSSGFGTKVRSS
ARSTRATICVPTQIHATLEEVADVFFSDRTNAAIGFAASQQIYSLVEPSDERPLRACGLR
WSLWHSPSKLVRQRDILYIEYMDTFVDENGRRGWARVTRSIHHRSCPPLLHSHNVVRAHL
GCSGTTYTETDTPGVLDVVTLYDCDTKGVPAWLTKFVAVRKAKNAHLLEHLIRLARAAND
SLVADFTKLVPAKQEKACVGCGDALPKWNVGGRKCRECKENVCKSCSDIVYCAVEGGKKL
NRICMHCVDRYLSTDVERSRVDMYTQLSTSSSSSSSRPRKASSYDESAPSNGSTRRRRSR
SSNSHSGSTDGADLDSPLPMLEDKPSSFPPSAPSSADSRQYGLRERAATQAARKQPPKLL
NLGVSRYRERKPPSGDIDLSYLASFKTVSSRS
Download sequence
Identical sequences K3W5B4
PYU1_T000155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]