SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3W5B5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3W5B5
Domain Number 1 Region: 74-231
Classification Level Classification E-value
Superfamily Bet v1-like 0.000000000288
Family CoxG-like 0.088
Further Details:      
 
Domain Number 2 Region: 227-326
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000576
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3W5B5
Sequence length 462
Comment (tr|K3W5B5|K3W5B5_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T000156} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MANRYRYSRSPDQPYAVDLHPLPAAEASALIHKAFTAFRKLFAAIQIAKHDDSDVARVAS
VSGDDGDNHQHSSSKSVMVCTSGLVYGTLEEVAALYVHDDSRMVLDFPDSKRLYTLAEPS
KASPMRCAGVRWSRWKSTSKLVSDRDMIYVEYMDTFTDPVAGRRGWARCTKSIVHPVCPE
SQHPDGPVRAQLHCSGIIMHETDTYGELEATLLVHMDTQGMPAFVAQKALNSRKKSLQHI
NHVLKLTRQMSGTPQSDDDMVLGGGSLTGDERACRSCNEHVSKWTRVRHCRYCDATLCKP
CALISYNQAADKEENPKTTRMCVDCGTGKKPRPVNGTGIAEDRPLSPSALAALSLQRPHV
YSKGRVNSSRSIDTESSVGSAREDTDELRHQRLRHASSVSSTSTTAQASQPGLQRMNSRQ
RGASNSSDMGSFRLAPAVKMDLSYLNDIVSAKPKASSNTESQ
Download sequence
Identical sequences K3W5B5
PYU1_T000156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]