SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3W5Y4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3W5Y4
Domain Number 1 Region: 407-462
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.000000445
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0057
Further Details:      
 
Domain Number 2 Region: 202-252
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.000000615
Family DEK C-terminal domain 0.0052
Further Details:      
 
Weak hits

Sequence:  K3W5Y4
Domain Number - Region: 328-397
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.017
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3W5Y4
Sequence length 462
Comment (tr|K3W5Y4|K3W5Y4_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T000375} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MEELQYAIQEAEDYLSTPEDIRLPPCMVPSDLDPTLEPPPPIEREVPMEAEEDAGEDDEV
ASEHDEEHDEDEDMDSDNDSKSKKKKEKKPKEKKTKEKKAAKEKKPAKAKKEKKSSSKKR
RRSGRIRGQKRKKPSADAEPSAAAAAGTKSSPTSASPSKVQKKEKAVDVKTEATALKPAK
TPKVKAETAAGNELNGEELSAVLEKEIKWILANCQFEEMTTKTVRKLLEKRLKMDLRHHK
ASIKEGVARVIASMDDVPDAPAGDEAPVKTEASADAAAPDAAASTTSATEEPEVAPIKPE
VEPEQETKREEAASEVKPEVKKEEDIAQRLVDAEKELGLALNEEPKIVNALTSLQQIPSV
EKEVLSSSVLLPRLVELRSHLDDSVSQLVASIATQWDVEDLVPAPKPVREEDILELKEKL
ENPETSHEDILTCLDQLTKMRLGMSHLTSTGIPRSVANLRQH
Download sequence
Identical sequences K3W5Y4
PYU1_T000375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]