SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3W6F6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3W6F6
Domain Number 1 Region: 3-93
Classification Level Classification E-value
Superfamily Ribosomal protein S16 1.44e-31
Family Ribosomal protein S16 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3W6F6
Sequence length 106
Comment (tr|K3W6F6|K3W6F6_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T000547} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MVVRLRLARWGRKDLPFYRIVAADARAPRDGKHLEILGTFNPIAAADGVKELRVNNERVR
YWISVGAQPSDRVSHLLGIANILPMPPTRQYGIKSIPKKDRAPAKK
Download sequence
Identical sequences K3W6F6
PYU1_T000547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]