SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3W6S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3W6S6
Domain Number 1 Region: 428-612
Classification Level Classification E-value
Superfamily Fibronectin type III 2.66e-26
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 2 Region: 38-236
Classification Level Classification E-value
Superfamily Fibronectin type III 4.92e-26
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 3 Region: 241-415
Classification Level Classification E-value
Superfamily Fibronectin type III 2.99e-25
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 4 Region: 619-699
Classification Level Classification E-value
Superfamily CalX-like 0.000000000144
Family CalX-beta domain 0.004
Further Details:      
 
Weak hits

Sequence:  K3W6S6
Domain Number - Region: 2-51
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0262
Family Fibronectin type III 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3W6S6
Sequence length 699
Comment (tr|K3W6S6|K3W6S6_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T000667} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MTRLLYSTEYKLKYKAFNAVGGSESSDVLVVSTKFISLPGEPRNVTLVDRTSGSASISWK
PPVDFGGTEVTSYQIAFFTGYEIRAQFTQVVSNVSENAASLTAKVSGLNATTSYGFFVVG
VNDVSACVDVATFTTYAILYATTLPMSPPLVPQNLNVTVSTPGMQVVTWSPTTDGGGDPT
VAYLLYSDLGILLYNGTQTQFKRGSLVPNTTYGYSVMTYNSVGASVLSPVVRRKTISGLI
VPSRPLDPMYVHATGGSISLQWSRPLDSGGENLKGYRVYRGSTLLVQEHLNTAFVDDIGL
IAEQEYVYTFQAENTLGVGPQSEAVVAHTTVATVPAAAANLTVLATGGRLAVAWTPPHDT
GGIPLETYRVQVDTIGTETLVDLLMEDTVYEYFGIFANTLYNASVVPMNKIGNGTKAFKT
VVNGKAIAPKAPLPPVIVSSDAQHAVLTLQSPVDSGGANITQLSLYQDGVHVRSVTSSGY
FQVSVGPLFANKVYAFTSTAVSILELGESPQSDTTEVTTANPTPPSSVYNVIVTRRAADS
LTLKWDGPDDIGGENVVYVVEYTIKANGTVATMETRLQGAVLTGLASSAAYMVRVRAENS
AGDSAWTSAIQGETDVSQRGTITLRPVETTVFENSSSLTLQLIRVNGSSSNITCYYTVGN
ATNATADTDYVLSMEADRHFSFADGESLKEFTVQIVNDD
Download sequence
Identical sequences K3W6S6
PYU1_T000667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]